Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.8: WrbA-like [117474] (3 proteins) |
Protein Trp repressor binding protein WrbA [117475] (4 species) |
Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries) Uniprot Q9RYU4 |
Domain d1yrhg2: 1yrh G:4-201 [123929] Other proteins in same PDB: d1yrha2, d1yrhb3, d1yrhc3, d1yrhd3, d1yrhf3, d1yrhg3, d1yrhh3 automated match to d1ydge_ complexed with fmn |
PDB Entry: 1yrh (more details), 3.11 Å
SCOPe Domain Sequences for d1yrhg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrhg2 c.23.5.8 (G:4-201) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras irhqvrrqveltaklleg
Timeline for d1yrhg2: