Lineage for d1yrhd2 (1yrh D:3-201)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856848Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2856857Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2856858Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. 2856870Domain d1yrhd2: 1yrh D:3-201 [123926]
    Other proteins in same PDB: d1yrha2, d1yrhb3, d1yrhc3, d1yrhd3, d1yrhf3, d1yrhg3, d1yrhh3
    automated match to d1ydge_
    complexed with fmn

Details for d1yrhd2

PDB Entry: 1yrh (more details), 3.11 Å

PDB Description: crystal structure of trp repressor binding protein wrba in complex with fmn
PDB Compounds: (D:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1yrhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrhd2 c.23.5.8 (D:3-201) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
sirhqvrrqveltaklleg

SCOPe Domain Coordinates for d1yrhd2:

Click to download the PDB-style file with coordinates for d1yrhd2.
(The format of our PDB-style files is described here.)

Timeline for d1yrhd2: