Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1yrhf1 (1yrh F:4-199)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.8: WrbA-like [117474] (3 protein domains)
  6. Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. Domain d1yrhf1: 1yrh F:4-199 [123928]
    automatically matched to 1YRH A:4-199
    complexed with fmn

Details for d1yrhf1

PDB Entry: 1yrh (more details)
PDB Description: crystal structure of trp repressor binding protein wrba in complex with fmn
PDB Compounds: (F:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d1yrhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrhf1 c.23.5.8 (F:4-199) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
irhqvrrqveltakll

SCOP Domain Coordinates for d1yrhf1:

Click to download the PDB-style file with coordinates for d1yrhf1.
(The format of our PDB-style files is described here.)

Timeline for d1yrhf1:

d1yrhf1 appears in SCOP 1.75A


d1yrhf1
(click for larger image)


d1yrhf1 in context of chain



d1yrhf1 in context of PDB
Domains from other chains:
d1yrha1, d1yrhb1, d1yrhc1, d1yrhd1, d1yrhe1, d1yrhg1, d1yrhh1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu