PDB entry 1yrh

View 1yrh on RCSB PDB site
Description: Crystal Structure Of Trp Repressor Binding Protein Wrba in complex with FMN
Class: protein binding
Keywords: alpha-beta twisted open sheet, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, PROTEIN BINDING
Deposited on 2005-02-03, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrha1, d1yrha2
  • Chain 'B':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrhb2, d1yrhb3
  • Chain 'C':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrhc2, d1yrhc3
  • Chain 'D':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrhd2, d1yrhd3
  • Chain 'E':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
    Domains in SCOPe 2.07: d1yrhe_
  • Chain 'F':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrhf2, d1yrhf3
  • Chain 'G':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrhg2, d1yrhg3
  • Chain 'H':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • modified residue (22)
      • modified residue (64)
      • modified residue (96)
      • modified residue (120)
      • modified residue (139)
      • modified residue (142)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOPe 2.07: d1yrhh2, d1yrhh3
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrhA (A:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhA (A:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleggs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrhB (B:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhB (B:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleggs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yrhC (C:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhC (C:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yrhD (D:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhD (D:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yrhE (E:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhE (E:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yrhF (F:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhF (F:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yrhG (G:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhG (G:)
    pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
    kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
    nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
    irhqvrrqveltaklleggs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yrhH (H:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrhH (H:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs