Lineage for d1ypza1 (1ypz A:181-276)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021496Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 2021507Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries)
  8. 2021512Domain d1ypza1: 1ypz A:181-276 [123837]
    Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2
    automatically matched to d1c16a1

Details for d1ypza1

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: Immune receptor
PDB Compounds: (A:) H2-T22 protein

SCOPe Domain Sequences for d1ypza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypza1 b.1.1.2 (A:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

SCOPe Domain Coordinates for d1ypza1:

Click to download the PDB-style file with coordinates for d1ypza1.
(The format of our PDB-style files is described here.)

Timeline for d1ypza1: