![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d1ypzd1: 1ypz D:1-99 [123842] Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzc1, d1ypzc2, d1ypze1, d1ypze2, d1ypzf1, d1ypzf2, d1ypzg1, d1ypzg2, d1ypzh1, d1ypzh2 automatically matched to d1a9bb_ |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypzd1 b.1.1.2 (D:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1ypzd1: