Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63661] (2 PDB entries) |
Domain d1ypzh2: 1ypz H:121-230 [144715] Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze1, d1ypzf1, d1ypzg1, d1ypzh1 automatically matched to 1YPZ F:121-230 |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypzh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypzh2 b.1.1.2 (H:121-230) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} dkrldadispkptiflpsvaetnlhktgtylclleaffpdvirvywkekdgntildsqeg dtlktndtymkfswltvperamgkehrcivkhennkggadqaiffpsikk
Timeline for d1ypzh2: