Lineage for d1ypze1 (1ypz E:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2741978Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries)
  8. 2741985Domain d1ypze1: 1ypz E:1-119 [144708]
    Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze2, d1ypzf2, d1ypzg2, d1ypzh2

Details for d1ypze1

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: immune receptor
PDB Compounds: (E:) T cell receptor delta

SCOPe Domain Sequences for d1ypze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypze1 b.1.1.1 (E:1-119) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaadtwhisegyelgtdklvfgqgtqvtvepk

SCOPe Domain Coordinates for d1ypze1:

Click to download the PDB-style file with coordinates for d1ypze1.
(The format of our PDB-style files is described here.)

Timeline for d1ypze1: