SCOPe 2.08: Domain d1ypze2: 1ypz E:120-207

Lineage for d1ypze2 (1ypz E:120-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (2 PDB entries)

8. Domain d1ypze2: 1ypz E:120-207 [144709]
   Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze1, d1ypzf1, d1ypzg1, d1ypzh1

Details for d1ypze2

PDB Entry: 1ypz, 3.4 Å

PDB Description: immune receptor

PDB Compounds: (E:) T cell receptor delta

SCOPe Domain Sequences for d1ypze2:

Sequence; same for both SEQRES and ATOM records:

>d1ypze2 b.1.1.2 (E:120-207) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
sqppakpsvfimkngtnvaclvkdfypkevtislrsskkivefdpaivispsgkysavkl
gqygdsnsvtcsvqhnsetvhstdfeaa

Timeline for d1ypze2:

• d1ypze2 first appeared in SCOP 1.75
  
• d1ypze2 appears in SCOPe 2.07