SCOP 1.73: Domain d1ypza1: 1ypz A:181-276

Lineage for d1ypza1 (1ypz A:181-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries)

8. Domain d1ypza1: 1ypz A:181-276 [123837]
   Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1
   automatically matched to d1c16a1
   complexed with fuc, man, nag

Details for d1ypza1

PDB Entry: 1ypz, 3.4 Å

PDB Description: immune receptor

PDB Compounds: (A:) H2-T22 protein

SCOP Domain Sequences for d1ypza1:

Sequence; same for both SEQRES and ATOM records:

>d1ypza1 b.1.1.2 (A:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

Timeline for d1ypza1:

• d1ypza1 is new in SCOP 1.73
  
• d1ypza1 appears in SCOP 1.75
  
• d1ypza1 appears in the current release, SCOPe 2.08