Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries) |
Domain d1ypza1: 1ypz A:181-276 [123837] Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1 automatically matched to d1c16a1 complexed with fuc, man, nag |
PDB Entry: 1ypz (more details), 3.4 Å
SCOP Domain Sequences for d1ypza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypza1 b.1.1.2 (A:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt fqkwaavvvplgkeqsytchvyheglpeplilrwgg
Timeline for d1ypza1:
View in 3D Domains from other chains: (mouse over for more information) d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1 |