Lineage for d1ypzc1 (1ypz C:181-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654519Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 654530Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries)
  8. 654536Domain d1ypzc1: 1ypz C:181-276 [123840]
    Other proteins in same PDB: d1ypza2, d1ypzb1, d1ypzc2, d1ypzd1
    automatically matched to d1c16a1
    complexed with fuc, man, nag

Details for d1ypzc1

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: immune receptor
PDB Compounds: (C:) H2-T22 protein

SCOP Domain Sequences for d1ypzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypzc1 b.1.1.2 (C:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

SCOP Domain Coordinates for d1ypzc1:

Click to download the PDB-style file with coordinates for d1ypzc1.
(The format of our PDB-style files is described here.)

Timeline for d1ypzc1: