| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
| Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (2 PDB entries) |
| Domain d1c16a1: 1c16 A:181-276 [20856] Other proteins in same PDB: d1c16a2, d1c16b_, d1c16c2, d1c16d_, d1c16e2, d1c16f_, d1c16g2, d1c16h_ |
PDB Entry: 1c16 (more details), 3.1 Å
SCOP Domain Sequences for d1c16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c16a1 b.1.1.2 (A:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg
Timeline for d1c16a1: