SCOPe 2.08: Domain d1y18a1: 1y18 A:1-107

Lineage for d1y18a1 (1y18 A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)

8. Domain d1y18a1: 1y18 A:1-107 [122521]
   Other proteins in same PDB: d1y18a2, d1y18b1, d1y18b2, d1y18c2, d1y18d1, d1y18d2, d1y18e2, d1y18f1, d1y18f2, d1y18h1, d1y18h2, d1y18l2
   automatically matched to d1g9ml1
   complexed with cl, han; mutant

Details for d1y18a1

PDB Entry: 1y18, 2.8 Å

PDB Description: fab fragment of catalytic elimination antibody 34e4 e(h50)d mutant in complex with hapten

PDB Compounds: (A:) Catalytic antibody 34E4 light chain

SCOPe Domain Sequences for d1y18a1:

Sequence; same for both SEQRES and ATOM records:

>d1y18a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik

Timeline for d1y18a1:

• d1y18a1 first appeared in SCOP 1.73
  
• d1y18a1 appears in SCOPe 2.07