SCOPe 2.08: Domain d1y18d1: 1y18 D:1-113

Lineage for d1y18d1 (1y18 D:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d1y18d1: 1y18 D:1-113 [122527]
   Other proteins in same PDB: d1y18a1, d1y18a2, d1y18b2, d1y18c1, d1y18c2, d1y18d2, d1y18e1, d1y18e2, d1y18f2, d1y18h2, d1y18l1, d1y18l2
   automatically matched to d1aqkh1
   complexed with cl, han; mutant

Details for d1y18d1

PDB Entry: 1y18, 2.8 Å

PDB Description: fab fragment of catalytic elimination antibody 34e4 e(h50)d mutant in complex with hapten

PDB Compounds: (D:) Catalytic antibody 34E4 heavy chain

SCOPe Domain Sequences for d1y18d1:

Sequence; same for both SEQRES and ATOM records:

>d1y18d1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigdinpdsrtiny
mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
vss

Timeline for d1y18d1:

• d1y18d1 first appeared in SCOP 1.73
  
• d1y18d1 appears in SCOPe 2.07