Lineage for d1y18h2 (1y18 H:114-233)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022298Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2022509Domain d1y18h2: 1y18 H:114-233 [122534]
    Other proteins in same PDB: d1y18a1, d1y18a2, d1y18b1, d1y18c1, d1y18c2, d1y18d1, d1y18e1, d1y18e2, d1y18f1, d1y18h1, d1y18l1, d1y18l2
    automatically matched to d1aqkh2
    complexed with cl, han; mutant

Details for d1y18h2

PDB Entry: 1y18 (more details), 2.8 Å

PDB Description: Fab fragment of catalytic elimination antibody 34E4 E(H50)D mutant in complex with hapten
PDB Compounds: (H:) Catalytic antibody 34E4 heavy chain

SCOPe Domain Sequences for d1y18h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y18h2 b.1.1.2 (H:114-233) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d1y18h2:

Click to download the PDB-style file with coordinates for d1y18h2.
(The format of our PDB-style files is described here.)

Timeline for d1y18h2: