![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
![]() | Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (15 PDB entries) |
![]() | Domain d1xz0a2: 1xz0 A:7-183 [122462] Other proteins in same PDB: d1xz0a1, d1xz0b_, d1xz0c1, d1xz0d_ automated match to d3t8xa1 complexed with jh0 |
PDB Entry: 1xz0 (more details), 2.8 Å
SCOPe Domain Sequences for d1xz0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz0a2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d1xz0a2:
![]() Domains from other chains: (mouse over for more information) d1xz0b_, d1xz0c1, d1xz0c2, d1xz0d_ |