![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries) |
![]() | Domain d1xz0a1: 1xz0 A:184-277 [122461] Other proteins in same PDB: d1xz0a2, d1xz0b_, d1xz0c2, d1xz0d_ automated match to d1gzqa1 complexed with jh0 |
PDB Entry: 1xz0 (more details), 2.8 Å
SCOPe Domain Sequences for d1xz0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz0a1 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]} qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw ylratlevaageaadlscrvkhsslegqdivlyw
Timeline for d1xz0a1:
![]() Domains from other chains: (mouse over for more information) d1xz0b_, d1xz0c1, d1xz0c2, d1xz0d_ |