Lineage for d1xz0a2 (1xz0 A:7-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719354Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 719355Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (3 PDB entries)
  8. 719359Domain d1xz0a2: 1xz0 A:7-183 [122462]
    Other proteins in same PDB: d1xz0a1, d1xz0b1, d1xz0c1, d1xz0d1
    automatically matched to d1onqa2
    complexed with fuc, jh0, nag

Details for d1xz0a2

PDB Entry: 1xz0 (more details), 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOP Domain Sequences for d1xz0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz0a2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOP Domain Coordinates for d1xz0a2:

Click to download the PDB-style file with coordinates for d1xz0a2.
(The format of our PDB-style files is described here.)

Timeline for d1xz0a2: