Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (3 PDB entries) |
Domain d1xz0a2: 1xz0 A:7-183 [122462] Other proteins in same PDB: d1xz0a1, d1xz0b1, d1xz0c1, d1xz0d1 automatically matched to d1onqa2 complexed with fuc, jh0, nag |
PDB Entry: 1xz0 (more details), 2.8 Å
SCOP Domain Sequences for d1xz0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz0a2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d1xz0a2:
View in 3D Domains from other chains: (mouse over for more information) d1xz0b1, d1xz0c1, d1xz0c2, d1xz0d1 |