SCOPe 2.07: Domain d1xz0a2: 1xz0 A:7-183

Lineage for d1xz0a2 (1xz0 A:7-183)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (15 PDB entries)

8. Domain d1xz0a2: 1xz0 A:7-183 [122462]
   Other proteins in same PDB: d1xz0a1, d1xz0b_, d1xz0c1, d1xz0d_
   automated match to d3t8xa1
   complexed with jh0

Details for d1xz0a2

PDB Entry: 1xz0, 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1xz0a2:

Sequence; same for both SEQRES and ATOM records:

>d1xz0a2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Timeline for d1xz0a2:

• d1xz0a2 first appeared in SCOP 1.73
  
• d1xz0a2 appears in SCOPe 2.06
  
• d1xz0a2 appears in the current release, SCOPe 2.08