Lineage for d1xz0c2 (1xz0 C:8-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937580Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)
  8. 2937597Domain d1xz0c2: 1xz0 C:8-183 [122465]
    Other proteins in same PDB: d1xz0a1, d1xz0b_, d1xz0c1, d1xz0d_
    automated match to d3t8xa1
    complexed with jh0

Details for d1xz0c2

PDB Entry: 1xz0 (more details), 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide
PDB Compounds: (C:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1xz0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz0c2 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
lsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkele
tlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsfq
nnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d1xz0c2:

Click to download the PDB-style file with coordinates for d1xz0c2.
(The format of our PDB-style files is described here.)

Timeline for d1xz0c2: