SCOPe 2.08: Domain d1xvdc_: 1xvd C:

Lineage for d1xvdc_ (1xvd C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1xvdc_: 1xvd C: [122358]
   Other proteins in same PDB: d1xvda_, d1xvdb_, d1xvde_, d1xvdf_
   automated match to d1fyzc_
   complexed with fe, fpn
   has additional insertions and/or extensions that are not grouped together

Details for d1xvdc_

PDB Entry: 1xvd, 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure

PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xvdc_:

Sequence; same for both SEQRES and ATOM records:

>d1xvdc_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1xvdc_:

• d1xvdc_ first appeared in SCOP 1.73, called d1xvdc1
  
• d1xvdc_ appears in SCOPe 2.07