Lineage for d1xmfc1 (1xmf C:2-389)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703395Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 2703396Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 2703449Domain d1xmfc1: 1xmf C:2-389 [122149]
    Other proteins in same PDB: d1xmfa_, d1xmfb_, d1xmfe_, d1xmff_
    complexed with ca, mn
    has additional insertions and/or extensions that are not grouped together

Details for d1xmfc1

PDB Entry: 1xmf (more details), 2.32 Å

PDB Description: structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xmfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmfc1 a.25.1.2 (C:2-389) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaevilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1xmfc1:

Click to download the PDB-style file with coordinates for d1xmfc1.
(The format of our PDB-style files is described here.)

Timeline for d1xmfc1: