Lineage for d1xmfb_ (1xmf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703338Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 2703339Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 2703389Domain d1xmfb_: 1xmf B: [122148]
    Other proteins in same PDB: d1xmfc1, d1xmfd_, d1xmfe_, d1xmff_
    automated match to d1fz1a_
    complexed with ca, mn

    has additional subdomain(s) that are not in the common domain

Details for d1xmfb_

PDB Entry: 1xmf (more details), 2.32 Å

PDB Description: structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
PDB Compounds: (B:) Methane monooxygenase component A alpha chain

SCOPe Domain Sequences for d1xmfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmfb_ a.25.1.2 (B:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
qphvrgdklwtlddikrlncvfknpvkafn

SCOPe Domain Coordinates for d1xmfb_:

Click to download the PDB-style file with coordinates for d1xmfb_.
(The format of our PDB-style files is described here.)

Timeline for d1xmfb_: