SCOP 1.73: Domain d1xltg1: 1xlt G:144-326

Lineage for d1xltg1 (1xlt G:144-326)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)

8. Domain d1xltg1: 1xlt G:144-326 [122132]
   Other proteins in same PDB: d1xlta2, d1xltb2, d1xltc1, d1xltd2, d1xlte2, d1xltf1, d1xltg2, d1xlth2, d1xlti1
   automatically matched to d1f8ga1
   complexed with na, nad, ndp, suc

Details for d1xltg1

PDB Entry: 1xlt, 3.1 Å

PDB Description: crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex

PDB Compounds: (G:) NAD(P) transhydrogenase subunit alpha part 1

SCOP Domain Sequences for d1xltg1:

Sequence, based on SEQRES records:

>d1xltg1 c.2.1.4 (G:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records):

>d1xltg1 c.2.1.4 (G:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvdgeefrkkqaeavlkelvktdiaittalipgkpapvliteem
vtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

Timeline for d1xltg1:

• d1xltg1 is new in SCOP 1.73
  
• d1xltg1 appears in SCOP 1.75
  
• d1xltg1 appears in the current release, SCOPe 2.08