| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode |
| Protein Transhydrogenase domain III (dIII) [52485] (3 species) |
| Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries) |
| Domain d1xltc1: 1xlt C:291-464 [122126] Other proteins in same PDB: d1xlta1, d1xlta2, d1xltb1, d1xltb2, d1xltd1, d1xltd2, d1xlte1, d1xlte2, d1xltg1, d1xltg2, d1xlth1, d1xlth2 automatically matched to d1pnoa_ complexed with na, nad, ndp, suc |
PDB Entry: 1xlt (more details), 3.1 Å
SCOP Domain Sequences for d1xltc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xltc1 c.31.1.4 (C:291-464) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
rhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Timeline for d1xltc1: