SCOP 1.73: Domain d1xltd2: 1xlt D:1-143,D:327-378

Lineage for d1xltd2 (1xlt D:1-143,D:327-378)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)

8. Domain d1xltd2: 1xlt D:1-143,D:327-378 [122128]
   Other proteins in same PDB: d1xlta1, d1xltb1, d1xltc1, d1xltd1, d1xlte1, d1xltf1, d1xltg1, d1xlth1, d1xlti1
   automatically matched to d1f8ga2
   complexed with na, nad, ndp, suc

Details for d1xltd2

PDB Entry: 1xlt, 3.1 Å

PDB Description: crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex

PDB Compounds: (D:) NAD(P) transhydrogenase subunit alpha part 1

SCOP Domain Sequences for d1xltd2:

Sequence; same for both SEQRES and ATOM records:

>d1xltd2 c.23.12.2 (D:1-143,D:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa

Timeline for d1xltd2:

• d1xltd2 is new in SCOP 1.73
  
• d1xltd2 appears in SCOP 1.75
  
• d1xltd2 appears in the current release, SCOPe 2.08