Lineage for d1xlta1 (1xlt A:144-326)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687750Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 687779Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 687780Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)
  8. 687813Domain d1xlta1: 1xlt A:144-326 [122122]
    Other proteins in same PDB: d1xlta2, d1xltb2, d1xltc1, d1xltd2, d1xlte2, d1xltf1, d1xltg2, d1xlth2, d1xlti1
    automatically matched to d1f8ga1
    complexed with na, nad, ndp, suc

Details for d1xlta1

PDB Entry: 1xlt (more details), 3.1 Å

PDB Description: crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex
PDB Compounds: (A:) NAD(P) transhydrogenase subunit alpha part 1

SCOP Domain Sequences for d1xlta1:

Sequence, based on SEQRES records: (download)

>d1xlta1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1xlta1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddefrkkqaeavlkelvktdiaittalipgkpapvliteemv
tkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

SCOP Domain Coordinates for d1xlta1:

Click to download the PDB-style file with coordinates for d1xlta1.
(The format of our PDB-style files is described here.)

Timeline for d1xlta1: