Lineage for d1xdmb_ (1xdm B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [254964] (6 PDB entries)
  8. Domain d1xdmb_: 1xdm B: [121881]
    automated match to d1fdja_
    complexed with so4

Details for d1xdmb_

PDB Entry: 1xdm (more details), 3 Å

PDB Description: Structure of human aldolase B associated with hereditary fructose intolerance (A149P), at 291K
PDB Compounds: (B:) Fructose-bisphosphate aldolase B

SCOPe Domain Sequences for d1xdmb_:

Sequence, based on SEQRES records: (download)

>d1xdmb_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens) [TaxId: 9606]}
altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnkettiq
gldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicqqnglvpi
vepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghactkkytp
eqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfsygral
qasalaawggkaankeatqeafmkramancqaakgqyvht

Sequence, based on observed residues (ATOM records): (download)

>d1xdmb_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens) [TaxId: 9606]}
altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgiklddglsercaqykkdgvd
fgkwrpsslaiqenanalaryasicqqnglvpivepevipddlehcqyvtekvlaavyka
lndhhvylegtllkpnmvtkkytpeqvamatvtalhrtvpaavpgicflsggmseedatl
nlnainlcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgq
yvht

SCOPe Domain Coordinates for d1xdmb_ are not available.

Timeline for d1xdmb_:

Domains from other chains:
(mouse over for more information)
d1xdma_, d1xdmc_, d1xdmd_, d1xdmw_, d1xdmx_, d1xdmy_, d1xdmz_