Lineage for d1xdmb1 (1xdm B:6-343)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684106Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)
  7. 684125Species Human (Homo sapiens), liver isozyme [TaxId:9606] [51578] (3 PDB entries)
  8. 684145Domain d1xdmb1: 1xdm B:6-343 [121881]
    automatically matched to 1XDL A:6-343
    complexed with so4; mutant

Details for d1xdmb1

PDB Entry: 1xdm (more details), 3 Å

PDB Description: Structure of human aldolase B associated with hereditary fructose intolerance (A149P), at 291K
PDB Compounds: (B:) Fructose-bisphosphate aldolase B

SCOP Domain Sequences for d1xdmb1:

Sequence, based on SEQRES records: (download)

>d1xdmb1 c.1.10.1 (B:6-343) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]}
altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnkettiq
gldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicqqnglvpi
vepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghactkkytp
eqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfsygral
qasalaawggkaankeatqeafmkramancqaakgqyv

Sequence, based on observed residues (ATOM records): (download)

>d1xdmb1 c.1.10.1 (B:6-343) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]}
altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgiklddglsercaqykkdgvd
fgkwrpsslaiqenanalaryasicqqnglvpivepevipddlehcqyvtekvlaavyka
lndhhvylegtllkpnmvtkkytpeqvamatvtalhrtvpaavpgicflsggmseedatl
nlnainlcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgq
yv

SCOP Domain Coordinates for d1xdmb1:

Click to download the PDB-style file with coordinates for d1xdmb1.
(The format of our PDB-style files is described here.)

Timeline for d1xdmb1: