Lineage for d1fdja_ (1fdj A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. Species Rabbit (Oryctolagus cuniculus), liver isozyme [TaxId:9986] [63920] (1 PDB entry)
  8. Domain d1fdja_: 1fdj A: [59772]
    complexed with 13p, 2fp, g3p, so4

Details for d1fdja_

PDB Entry: 1fdj (more details), 2.1 Å

PDB Description: fructose 1,6-bisphosphate aldolase from rabbit liver
PDB Compounds: (A:) fructose 1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1fdja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdja_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), liver isozyme [TaxId: 9986]}
ahrfpaltpeqkkelsdiaqrivangkgilaadesvgtmgnrlqrikvenseenrrqfre
ilftvdnsinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnk
ettiqgldglsercaqykkdgvdfgkwravlriadqcpsslaiqenantlaryasicqqn
glvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghact
kkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfs
ygralqasalaawggkaenkkatqeafmkravvncqaakgqyvhtgssgaastqslftas
yty

SCOPe Domain Coordinates for d1fdja_ are not available.

Timeline for d1fdja_:

Domains from other chains:
(mouse over for more information)
d1fdjb_, d1fdjc_, d1fdjd_