Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein Nuclear receptor corepressor 2 [140171] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140172] (1 PDB entry) Uniprot Q9Y618 413-480 |
Domain d1xc5a1: 1xc5 A:413-480 [121850] |
PDB Entry: 1xc5 (more details)
SCOPe Domain Sequences for d1xc5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} nglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecvlyyyl tkknenyk
Timeline for d1xc5a1: