SCOPe 2.07: Domain d1xc5a1: 1xc5 A:413-480

Lineage for d1xc5a1 (1xc5 A:413-480)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein Nuclear receptor corepressor 2 [140171] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140172] (1 PDB entry)
   Uniprot Q9Y618 413-480

8. Domain d1xc5a1: 1xc5 A:413-480 [121850]

Details for d1xc5a1

PDB Entry: 1xc5

PDB Description: solution structure of the smrt deacetylase activation domain

PDB Compounds: (A:) Nuclear receptor corepressor 2

SCOPe Domain Sequences for d1xc5a1:

Sequence; same for both SEQRES and ATOM records:

>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]}
nglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecvlyyyl
tkknenyk

Timeline for d1xc5a1:

• d1xc5a1 first appeared in SCOP 1.73
  
• d1xc5a1 appears in SCOPe 2.06
  
• d1xc5a1 appears in the current release, SCOPe 2.08