PDB entry 1xc5

View 1xc5 on RCSB PDB site
Description: Solution Structure of the SMRT Deacetylase Activation Domain
Class: transcription corepressor
Keywords: four-helix structure, three-helix triangle, TRANSCRIPTION COREPRESSOR
Deposited on 2004-09-01, released 2005-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xc5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xc5A (A:)
gsmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecvly
yyltkknenyk

    Sequence, based on observed residues (ATOM records): (download) 
    >1xc5A (A:)
nglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecvlyyyl
tkknenyk