Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
Protein automated matches [190669] (6 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [188102] (1 PDB entry) |
Domain d1wz8b_: 1wz8 B: [121484] Other proteins in same PDB: d1wz8a1 automated match to d1wz8a1 complexed with mpd |
PDB Entry: 1wz8 (more details), 1.8 Å
SCOPe Domain Sequences for d1wz8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wz8b_ c.14.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl gfsgkeleeglkalkekrppefp
Timeline for d1wz8b_: