Lineage for d1wz8a1 (1wz8 A:2-264)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853273Protein Probable enoyl-CoA hydratase TTHA0218 [142000] (1 species)
  7. 2853274Species Thermus thermophilus [TaxId:274] [142001] (1 PDB entry)
    Uniprot Q5SLS5 2-264
  8. 2853275Domain d1wz8a1: 1wz8 A:2-264 [121483]
    Other proteins in same PDB: d1wz8b_, d1wz8c_, d1wz8d_, d1wz8e_, d1wz8f_
    complexed with mpd

Details for d1wz8a1

PDB Entry: 1wz8 (more details), 1.8 Å

PDB Description: Crystal Structure of Probable Enoyl-CoA Dehydratase from Thermus Thermophilus HB8
PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d1wz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}
laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
gfsgkeleeglkalkekrppefp

SCOPe Domain Coordinates for d1wz8a1:

Click to download the PDB-style file with coordinates for d1wz8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wz8a1: