Lineage for d1wz8c_ (1wz8 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853276Protein automated matches [190669] (6 species)
    not a true protein
  7. 2853339Species Thermus thermophilus HB8 [TaxId:300852] [188102] (1 PDB entry)
  8. 2853341Domain d1wz8c_: 1wz8 C: [121485]
    Other proteins in same PDB: d1wz8a1
    automated match to d1wz8a1
    complexed with mpd

Details for d1wz8c_

PDB Entry: 1wz8 (more details), 1.8 Å

PDB Description: Crystal Structure of Probable Enoyl-CoA Dehydratase from Thermus Thermophilus HB8
PDB Compounds: (C:) enoyl-coa hydratase

SCOPe Domain Sequences for d1wz8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz8c_ c.14.1.3 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
gfsgkeleeglkalkekrppefp

SCOPe Domain Coordinates for d1wz8c_:

Click to download the PDB-style file with coordinates for d1wz8c_.
(The format of our PDB-style files is described here.)

Timeline for d1wz8c_: