SCOP 1.73: Domain d1wz8b1: 1wz8 B:2-264

Lineage for d1wz8b1 (1wz8 B:2-264)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Probable enoyl-CoA hydratase TTHA0218 [142000] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142001] (1 PDB entry)

8. Domain d1wz8b1: 1wz8 B:2-264 [121484]
   automatically matched to 1WZ8 A:2-264
   complexed with mpd

Details for d1wz8b1

PDB Entry: 1wz8, 1.8 Å

PDB Description: Crystal Structure of Probable Enoyl-CoA Dehydratase from Thermus Thermophilus HB8

PDB Compounds: (B:) enoyl-coa hydratase

SCOP Domain Sequences for d1wz8b1:

Sequence; same for both SEQRES and ATOM records:

>d1wz8b1 c.14.1.3 (B:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}
laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
gfsgkeleeglkalkekrppefp

Timeline for d1wz8b1:

• d1wz8b1 is new in SCOP 1.73
  
• d1wz8b1 appears in SCOP 1.75
  
• d1wz8b1 appears in the current release, SCOPe 2.08, called d1wz8b_