![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.11: Asparaginyl hydroxylase-like [141633] (1 protein) Pfam PF08007 |
![]() | Protein Putative asparaginyl hydroxylase YxbC [141634] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141635] (1 PDB entry) Uniprot P46327 8-326 |
![]() | Domain d1vrbd_: 1vrb D: [120453] automated match to d1vrba1 complexed with fe |
PDB Entry: 1vrb (more details), 2.6 Å
SCOPe Domain Sequences for d1vrbd_:
Sequence, based on SEQRES records: (download)
>d1vrbd_ b.82.2.11 (D:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} svlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvv gdavieesegitdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpag tsskaivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyyp ddlqsywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawld lmlaalrkklisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqs qdsdfdpyqstqlvfrqllt
>d1vrbd_ b.82.2.11 (D:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} svlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvv gdavieesdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtssk aivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyypddlq sywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmla alrkklisdnrfrelavnhqesskselngylesliqtlsenaetltpeqifqsqdsdfdp yqstqlvfrqllt
Timeline for d1vrbd_: