Lineage for d1vrbd_ (1vrb D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071084Family b.82.2.11: Asparaginyl hydroxylase-like [141633] (1 protein)
    Pfam PF08007
  6. 2071085Protein Putative asparaginyl hydroxylase YxbC [141634] (1 species)
  7. 2071086Species Bacillus subtilis [TaxId:1423] [141635] (1 PDB entry)
    Uniprot P46327 8-326
  8. 2071090Domain d1vrbd_: 1vrb D: [120453]
    automated match to d1vrba1
    complexed with fe

Details for d1vrbd_

PDB Entry: 1vrb (more details), 2.6 Å

PDB Description: Crystal structure of Putative asparaginyl hydroxylase (2636534) from Bacillus subtilis at 2.60 A resolution
PDB Compounds: (D:) Putative asparaginyl hydroxylase

SCOPe Domain Sequences for d1vrbd_:

Sequence, based on SEQRES records: (download)

>d1vrbd_ b.82.2.11 (D:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}
svlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvv
gdavieesegitdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpag
tsskaivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyyp
ddlqsywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawld
lmlaalrkklisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqs
qdsdfdpyqstqlvfrqllt

Sequence, based on observed residues (ATOM records): (download)

>d1vrbd_ b.82.2.11 (D:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}
svlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvv
gdavieesdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtssk
aivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyypddlq
sywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmla
alrkklisdnrfrelavnhqesskselngylesliqtlsenaetltpeqifqsqdsdfdp
yqstqlvfrqllt

SCOPe Domain Coordinates for d1vrbd_:

Click to download the PDB-style file with coordinates for d1vrbd_.
(The format of our PDB-style files is described here.)

Timeline for d1vrbd_: