Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.11: Asparaginyl hydroxylase-like [141633] (1 protein) Pfam PF08007 |
Protein Putative asparaginyl hydroxylase YxbC [141634] (1 species) |
Species Bacillus subtilis [TaxId:1423] [141635] (1 PDB entry) Uniprot P46327 8-326 |
Domain d1vrbc_: 1vrb C: [120452] automated match to d1vrba1 complexed with fe |
PDB Entry: 1vrb (more details), 2.6 Å
SCOPe Domain Sequences for d1vrbc_:
Sequence, based on SEQRES records: (download)
>d1vrbc_ b.82.2.11 (C:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvg davieesegitdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagt sskaivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyypd dlqsywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldl mlaalrkklisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqsq dsdfdpyqstqlvfrqllt
>d1vrbc_ b.82.2.11 (C:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvr flvspaealewyealefdftdlfipqvrrwieklkaelrlpagtsskaivyaaknggfka hfdaytnlifqiqgektwklaknenvsnpmqhydlsypddlqsywkgdppkedlpdaeiv nltpgtmlylprglwhstksdqatlalnitfgqpawldlmlaalrkklisdnrfrelavn hqslhesskselngylesliqtlsenaetltpeqifqsqdsdfdpyqstqlvfrqllt
Timeline for d1vrbc_: