Lineage for d1vrbb_ (1vrb B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.11: Asparaginyl hydroxylase-like [141633] (1 protein)
    Pfam PF08007
  6. Protein Putative asparaginyl hydroxylase YxbC [141634] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [141635] (1 PDB entry)
    Uniprot P46327 8-326
  8. Domain d1vrbb_: 1vrb B: [120451]
    automated match to d1vrba1
    complexed with fe

Details for d1vrbb_

PDB Entry: 1vrb (more details), 2.6 Å

PDB Description: Crystal structure of Putative asparaginyl hydroxylase (2636534) from Bacillus subtilis at 2.60 A resolution
PDB Compounds: (B:) Putative asparaginyl hydroxylase

SCOPe Domain Sequences for d1vrbb_:

Sequence, based on SEQRES records: (download)

>d1vrbb_ b.82.2.11 (B:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}
vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvg
davieesegitdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagt
sskaivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyypd
dlqsywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldl
mlaalrkklisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqsq
dsdfdpyqstqlvfrqllt

Sequence, based on observed residues (ATOM records): (download)

>d1vrbb_ b.82.2.11 (B:) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}
vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvg
davieesegrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtssk
aivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlypddlqsywkg
dppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmlaalrkk
lisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqsqdsdfdpyq
stqlvfrqllt

SCOPe Domain Coordinates for d1vrbb_ are not available.

Timeline for d1vrbb_:

Domains from other chains:
(mouse over for more information)
d1vrba1, d1vrbc_, d1vrbd_