PDB entry 1vrb

View 1vrb on RCSB PDB site
Description: Crystal structure of Putative asparaginyl hydroxylase (2636534) from Bacillus subtilis at 2.60 A resolution
Class: oxidoreductase
Keywords: 2636534, putative asparaginyl hydroxylase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, OXIDOREDUCTASE
Deposited on 2005-02-18, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative asparaginyl hydroxylase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46327
      • modified residue (29)
      • modified residue (75)
      • modified residue (185)
      • modified residue (226)
      • modified residue (259)
    Domains in SCOPe 2.07: d1vrba1
  • Chain 'B':
    Compound: Putative asparaginyl hydroxylase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46327
      • modified residue (29)
      • modified residue (75)
      • modified residue (185)
      • modified residue (226)
      • modified residue (259)
    Domains in SCOPe 2.07: d1vrbb_
  • Chain 'C':
    Compound: Putative asparaginyl hydroxylase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46327
      • modified residue (29)
      • modified residue (75)
      • modified residue (185)
      • modified residue (226)
      • modified residue (259)
    Domains in SCOPe 2.07: d1vrbc_
  • Chain 'D':
    Compound: Putative asparaginyl hydroxylase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46327
      • modified residue (29)
      • modified residue (75)
      • modified residue (185)
      • modified residue (226)
      • modified residue (259)
    Domains in SCOPe 2.07: d1vrbd_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vrbA (A:)
    mgsdkihhhhhhmsavtesvlesiispvtmsefleeywpvkplvargeverftsipgfek
    vrtlenvlaiynnpvmvvgdavieesegitdrflvspaealewyekgaalefdftdlfip
    qvrrwieklkaelrlpagtsskaivyaakngggfkahfdaytnlifqiqgektwklakne
    nvsnpmqhydlseapyypddlqsywkgdppkedlpdaeivnltpgtmlylprglwhstks
    dqatlalnitfgqpawldlmlaalrkklisdnrfrelavnhqslhesskselngylesli
    qtlsenaetltpeqifqsqdsdfdpyqstqlvfrqlltsykf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrbA (A:)
    vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvr
    flvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtsskaivyaakngg
    gfkahfdaytnlifqiqgektwklaknenvsnpmqhydlsypddlqsywkgdppkedlpd
    aeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmlaalrkklisdnrfre
    lavnhqslhesskselngylesliqtlsenaetltpeqifqsqdsdfdpyqstqlvfrql
    lt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vrbB (B:)
    mgsdkihhhhhhmsavtesvlesiispvtmsefleeywpvkplvargeverftsipgfek
    vrtlenvlaiynnpvmvvgdavieesegitdrflvspaealewyekgaalefdftdlfip
    qvrrwieklkaelrlpagtsskaivyaakngggfkahfdaytnlifqiqgektwklakne
    nvsnpmqhydlseapyypddlqsywkgdppkedlpdaeivnltpgtmlylprglwhstks
    dqatlalnitfgqpawldlmlaalrkklisdnrfrelavnhqslhesskselngylesli
    qtlsenaetltpeqifqsqdsdfdpyqstqlvfrqlltsykf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrbB (B:)
    vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvg
    davieesegrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtssk
    aivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlypddlqsywkg
    dppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmlaalrkk
    lisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqsqdsdfdpyq
    stqlvfrqllt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vrbC (C:)
    mgsdkihhhhhhmsavtesvlesiispvtmsefleeywpvkplvargeverftsipgfek
    vrtlenvlaiynnpvmvvgdavieesegitdrflvspaealewyekgaalefdftdlfip
    qvrrwieklkaelrlpagtsskaivyaakngggfkahfdaytnlifqiqgektwklakne
    nvsnpmqhydlseapyypddlqsywkgdppkedlpdaeivnltpgtmlylprglwhstks
    dqatlalnitfgqpawldlmlaalrkklisdnrfrelavnhqslhesskselngylesli
    qtlsenaetltpeqifqsqdsdfdpyqstqlvfrqlltsykf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrbC (C:)
    vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvr
    flvspaealewyealefdftdlfipqvrrwieklkaelrlpagtsskaivyaaknggfka
    hfdaytnlifqiqgektwklaknenvsnpmqhydlsypddlqsywkgdppkedlpdaeiv
    nltpgtmlylprglwhstksdqatlalnitfgqpawldlmlaalrkklisdnrfrelavn
    hqslhesskselngylesliqtlsenaetltpeqifqsqdsdfdpyqstqlvfrqllt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vrbD (D:)
    mgsdkihhhhhhmsavtesvlesiispvtmsefleeywpvkplvargeverftsipgfek
    vrtlenvlaiynnpvmvvgdavieesegitdrflvspaealewyekgaalefdftdlfip
    qvrrwieklkaelrlpagtsskaivyaakngggfkahfdaytnlifqiqgektwklakne
    nvsnpmqhydlseapyypddlqsywkgdppkedlpdaeivnltpgtmlylprglwhstks
    dqatlalnitfgqpawldlmlaalrkklisdnrfrelavnhqslhesskselngylesli
    qtlsenaetltpeqifqsqdsdfdpyqstqlvfrqlltsykf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrbD (D:)
    svlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvv
    gdavieesdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtssk
    aivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyypddlq
    sywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmla
    alrkklisdnrfrelavnhqesskselngylesliqtlsenaetltpeqifqsqdsdfdp
    yqstqlvfrqllt