Lineage for d1vrba1 (1vrb A:8-326)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.11: Asparaginyl hydroxylase-like [141633] (1 protein)
    Pfam PF08007
  6. Protein Putative asparaginyl hydroxylase YxbC [141634] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [141635] (1 PDB entry)
    Uniprot P46327 8-326
  8. Domain d1vrba1: 1vrb A:8-326 [120450]
    complexed with fe

Details for d1vrba1

PDB Entry: 1vrb (more details), 2.6 Å

PDB Description: Crystal structure of Putative asparaginyl hydroxylase (2636534) from Bacillus subtilis at 2.60 A resolution
PDB Compounds: (A:) Putative asparaginyl hydroxylase

SCOPe Domain Sequences for d1vrba1:

Sequence, based on SEQRES records: (download)

>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}
vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvg
davieesegitdrflvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagt
sskaivyaakngggfkahfdaytnlifqiqgektwklaknenvsnpmqhydlseapyypd
dlqsywkgdppkedlpdaeivnltpgtmlylprglwhstksdqatlalnitfgqpawldl
mlaalrkklisdnrfrelavnhqslhesskselngylesliqtlsenaetltpeqifqsq
dsdfdpyqstqlvfrqllt

Sequence, based on observed residues (ATOM records): (download)

>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}
vlesiispvtmsefleeywpvkplvargeverftsipgfekvrtlenvlaiynnpvmvvr
flvspaealewyekgaalefdftdlfipqvrrwieklkaelrlpagtsskaivyaakngg
gfkahfdaytnlifqiqgektwklaknenvsnpmqhydlsypddlqsywkgdppkedlpd
aeivnltpgtmlylprglwhstksdqatlalnitfgqpawldlmlaalrkklisdnrfre
lavnhqslhesskselngylesliqtlsenaetltpeqifqsqdsdfdpyqstqlvfrql
lt

SCOPe Domain Coordinates for d1vrba1 are not available.

Timeline for d1vrba1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vrbb_, d1vrbc_, d1vrbd_