Lineage for d1vq5w1 (1vq5 W:1-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726215Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 726216Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 726217Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 726218Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 726219Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
  8. 726247Domain d1vq5w1: 1vq5 W:1-154 [120123]
    Other proteins in same PDB: d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1ffkt_
    complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5w1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOP Domain Sequences for d1vq5w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5w1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1vq5w1:

Click to download the PDB-style file with coordinates for d1vq5w1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5w1: