SCOP 1.73: Domain d1vq5k1: 1vq5 K:1-132

Lineage for d1vq5k1 (1vq5 K:1-132)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (3 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)

8. Domain d1vq5k1: 1vq5 K:1-132 [120111]
   Other proteins in same PDB: d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
   automatically matched to d1s72k_
   complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5k1

PDB Entry: 1vq5, 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1vq5k1:

Sequence; same for both SEQRES and ATOM records:

>d1vq5k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1vq5k1:

• d1vq5k1 is new in SCOP 1.73
  
• d1vq5k1 appears in SCOP 1.75
  
• d1vq5k1 appears in the current release, SCOPe 2.08