Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
Protein Ribosomal protein L10e [54688] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries) |
Domain d1vq5h1: 1vq5 H:1-163 [120108] Other proteins in same PDB: d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1 automatically matched to d1s72h_ complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3 |
PDB Entry: 1vq5 (more details), 2.6 Å
SCOP Domain Sequences for d1vq5h1:
Sequence, based on SEQRES records: (download)
>d1vq5h1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]} kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri
>d1vq5h1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]} kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage qlftaycnvedaehvkeafrraynkitpscri
Timeline for d1vq5h1:
View in 3D Domains from other chains: (mouse over for more information) d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1 |