Lineage for d1vq5i1 (1vq5 I:71-140)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636030Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 636031Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 636032Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)
  7. 636033Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (22 PDB entries)
  8. 636050Domain d1vq5i1: 1vq5 I:71-140 [120109]
    Other proteins in same PDB: d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1s72i_
    complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5i1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOP Domain Sequences for d1vq5i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOP Domain Coordinates for d1vq5i1:

Click to download the PDB-style file with coordinates for d1vq5i1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5i1: