SCOP 1.73: Domain d1vq5z1: 1vq5 Z:10-82

Lineage for d1vq5z1 (1vq5 Z:10-82)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)

8. Domain d1vq5z1: 1vq5 Z:10-82 [120126]
   Other proteins in same PDB: d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1
   automatically matched to d1s72z_
   complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5z1

PDB Entry: 1vq5, 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d1vq5z1:

Sequence; same for both SEQRES and ATOM records:

>d1vq5z1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

Timeline for d1vq5z1:

• d1vq5z1 is new in SCOP 1.73
  
• d1vq5z1 appears in SCOP 1.75
  
• d1vq5z1 appears in the current release, SCOPe 2.08