SCOP 1.73: Domain d1vq5l1: 1vq5 L:1-150

Lineage for d1vq5l1 (1vq5 L:1-150)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)

8. Domain d1vq5l1: 1vq5 L:1-150 [120112]
   Other proteins in same PDB: d1vq511, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
   automatically matched to d1ffkj_
   complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq5l1

PDB Entry: 1vq5, 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (L:) 50S ribosomal protein L15P

SCOP Domain Sequences for d1vq5l1:

Sequence, based on SEQRES records:

>d1vq5l1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records):

>d1vq5l1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

Timeline for d1vq5l1:

• d1vq5l1 is new in SCOP 1.73
  
• d1vq5l1 appears in SCOP 1.75
  
• d1vq5l1 appears in the current release, SCOPe 2.08