Lineage for d1vcgc_ (1vcg C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. Protein automated matches [190228] (20 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [254915] (1 PDB entry)
  8. Domain d1vcgc_: 1vcg C: [119978]
    automated match to d3dh7a1
    complexed with fmn

Details for d1vcgc_

PDB Entry: 1vcg (more details), 3.02 Å

PDB Description: Crystal Structure of IPP isomerase at P43212
PDB Compounds: (C:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1vcgc_:

Sequence, based on SEQRES records: (download)

>d1vcgc_ c.1.4.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamtg
geengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaq
lrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvke
vghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarail
evrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyle
elrtalfaigarnpkeargrverv

Sequence, based on observed residues (ATOM records): (download)

>d1vcgc_ c.1.4.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
rinlalaeaaealgvgmmlgsgrillerpealrrvrkvapkallianlglaqlrrygrdd
llrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsre
aalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlph
lplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfa
igarnpkeargrverv

SCOPe Domain Coordinates for d1vcgc_ are not available.

Timeline for d1vcgc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vcga_, d1vcgb_, d1vcgd_