Lineage for d1vcgb_ (1vcg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080489Species Thermus thermophilus [TaxId:274] [254915] (1 PDB entry)
  8. 2080491Domain d1vcgb_: 1vcg B: [119977]
    automated match to d3dh7a1
    complexed with fmn

Details for d1vcgb_

PDB Entry: 1vcg (more details), 3.02 Å

PDB Description: Crystal Structure of IPP isomerase at P43212
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1vcgb_:

Sequence, based on SEQRES records: (download)

>d1vcgb_ c.1.4.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamtg
geengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaq
lrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvke
vghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarail
evrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyle
elrtalfaigarnpkeargrverv

Sequence, based on observed residues (ATOM records): (download)

>d1vcgb_ c.1.4.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
rinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygr
ddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghgls
reaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevl
phlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtal
faigarnpkeargrverv

SCOPe Domain Coordinates for d1vcgb_:

Click to download the PDB-style file with coordinates for d1vcgb_.
(The format of our PDB-style files is described here.)

Timeline for d1vcgb_: