SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vcgb_ (1vcg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (17 species)
    not a true protein
  7. 2080489Species Thermus thermophilus [TaxId:274] [254915] (1 PDB entry)
  8. 2080491Domain d1vcgb_: 1vcg B: [119977]
    automated match to d3dh7a1
    complexed with fmn

Details for d1vcgb_

PDB Entry: 1vcg (more details), 3.02 Å

PDB Description: Crystal Structure of IPP isomerase at P43212
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1vcgb_:

Sequence, based on SEQRES records: (download)

>d1vcgb_ c.1.4.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamtg
geengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaq
lrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvke
vghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarail
evrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyle
elrtalfaigarnpkeargrverv

Sequence, based on observed residues (ATOM records): (download)

>d1vcgb_ c.1.4.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
rinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygr
ddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghgls
reaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevl
phlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtal
faigarnpkeargrverv

SCOPe Domain Coordinates for d1vcgb_:

Click to download the PDB-style file with coordinates for d1vcgb_.
(The format of our PDB-style files is described here.)

Timeline for d1vcgb_: